PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN20881.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 393aa    MW: 42833 Da    PI: 6.0552
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN20881.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding582.2e-183883147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W++eEd ll ++v+q+G ++W+ Iar ++ gR++k+c++rw + 
       KHN20881.1 38 KGPWSPEEDALLSRLVAQFGARNWSMIARGVP-GRSGKSCRLRWCNQ 83
                     79******************************.***********985 PP

2Myb_DNA-binding58.51.5e-1890134147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r+++T+eEd ++v a++ +G++ W++Iar ++ gRt++ +k++w++ 
       KHN20881.1  90 RKPFTEEEDSIIVSAHAIHGNK-WAAIARLLP-GRTDNAIKNHWNST 134
                      789*******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129420.5813384IPR017930Myb domain
SuperFamilySSF466895.39E-3135131IPR009057Homeodomain-like
SMARTSM007179.6E-163786IPR001005SANT/Myb domain
PfamPF002496.3E-173883IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.8E-263991IPR009057Homeodomain-like
CDDcd001673.47E-154082No hitNo description
PROSITE profilePS5129425.69385139IPR017930Myb domain
SMARTSM007172.7E-1789137IPR001005SANT/Myb domain
PfamPF002496.7E-1690134IPR001005SANT/Myb domain
CDDcd001674.84E-1392135No hitNo description
Gene3DG3DSA:1.10.10.609.8E-2492138IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 393 aa     Download sequence    Send to blast
MTEEDRSAQE TVHNGVASTE LGGEEMDIAE VTAAGRVKGP WSPEEDALLS RLVAQFGARN  60
WSMIARGVPG RSGKSCRLRW CNQLDPCVKR KPFTEEEDSI IVSAHAIHGN KWAAIARLLP  120
GRTDNAIKNH WNSTLKRRCM EMGRYVPAHA DGMEDGTGSF DKTKASSEET MSIGDINSKN  180
PAEVRNVMMD NENKPPTKDD AKVEEHPTLH RPVARVSAFS VYNTPGRSTM GSCSKMFPRQ  240
SPLIQSPKPD VGSCKLFDDI DCEPMVPSQC GHGCCTGDSR ESHTHGSLLG PEFVDYLESP  300
SSSHAFISIA TDLNNIAWIK SGLENCSTGV TENTANLTAS RGVASALQTN FLGQDLKNGY  360
GQFEEGHGMF LGAMQEVLST KMARQHYAMP AEV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-39371386107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM0346281e-33KM034628.1 Jatropha curcas clone JcMYB007 MYB family protein gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003545242.10.0PREDICTED: myb-related protein 306-like
TrEMBLA0A0B2QH930.0A0A0B2QH93_GLYSO; Transcription factor MYB44
STRINGGLYMA14G06870.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF39863362
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55730.11e-100myb domain protein 109
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]